List website '5dollars' on 24 October 2019

The websites worth $5
No. Domain name
0 watersofteners4u.com
1 brendaholzke.com
2 just4medical.co.uk
3 upskirt-panty.com
4 jacksongravacoes.com
5 substancialmusic.com.br
6 ganymedes.nl
7 movea.com
8 classic-zone.de
9 peteratkinson.co.uk
10 tecnoline.it
11 threehillsobservatory.co.uk
12 altosdelcampo.com.ar
13 processandstorage.com
14 historicblackhillsstudios.org
15 enrichmarketing.co.uk
16 metrans.org
17 myadvanceddesign.com
18 thelocationcompanyny.com
19 agrooceanica.com.br
20 katscott.com
21 edthefridgeman.com.au
22 cetusmediaworks.com
23 magnuslarsson.com
24 fatbag.co.kr
25 clarkesystems.com
26 shahabbasrestaurant.com
27 sazhaemsad.ru
28 adacomunicazione.com
29 buttetheater.com
30 easyairporttaxis.com
31 murderdev.com
32 reference-cannabis.com
33 laprincessedemontpensier-lefilm.com
34 writeslikeshetalks.com
35 cascadiawebstudios.com
36 nicolasparies.com
37 learnseotricks.com
38 avlis.fr
39 parlorcitycrossfit.com
40 strictlyonlinebiz.com
41 todoparaeset.com
42 klubgrawitacja.com
43 axelspringerplugandplay.com
44 butikconcept.com
45 sohotmusic.com
46 captruss.com
47 decatur-nazarene.org
48 generationd.us
49 swaninn.com.au
50 bronikowo.pl
51 e36-kult.de
52 aislinnforbes.com
53 eliottlillyart.com
54 afromoths.net
55 campingbelvedere.com
56 lovs.biz
57 eaglepostalmansfield.com
58 solvangbrewing.com
59 kindlenewscenter.com
60 algraf.cz
61 netsstore.com
62 sundriedcycles.com
63 sexy123.net
64 devonashealthytalk.com
65 geburtstagsspiel.net
66 abnir.co.uk
67 sidbelloriginals.com
68 atouchofeleganceoc.com
69 ape50-ape80.de
70 centrevillepress.com
71 svlinx.de
72 assactiontube.com
73 saketgroup.org
74 healthsense.com.sg
75 hrgchoa.com
76 oit.edu.tw
77 semfim.net
78 drevenicezuberec.sk
79 lesschuhschuh.at
80 stalker-game.ru
81 foyou365.com
82 asempr.org
83 almusafir.ch
84 kumarithangkas.com
85 2emeelement.be
86 insulatedconservatoryceilings.org.uk
87 netfactual.com
88 loveodessa.com
89 sriyanova.com
90 diving.org.il
91 motocarbh.com.br
92 eaglecountry975.com
93 bigmonkeygroup.com
94 geilemannen.com
95 bluetenzauber.biz
96 anchorpest.net
97 mundosexo.co
98 net-bb.dk
99 nightofthedrinkingdead.com
100 hotelpik.pl
101 hambrightproperties.com
102 forumbijouterie.fr
103 wellnessfamilymedicine.net
104 kirtneill.com
105 rmjenvironomics.com
106 greenmastersmn.com
107 corneliaspelman.com
108 fliesen-rudroff.de
109 schwarzefrauentitten.com
110 chandlings.org.uk
111 squintfuckerpress.com
112 centrodememoriahistorica.gov.co
113 sligrofoodgroup.nl
114 sidetracs.com
115 rmtbristol.org.uk
116 marshfieldbusinessdirectory.com
117 kukerlandia.com
118 southcaperesort.com
119 airportreservations.com
120 rak.com.mx
121 247gaymen.com
122 essenimdunkeln.de
123 skweed.de
124 biolog.pl
125 doggietreats.com
126 dorothyratusny.com
127 cassettesandrecords.com
128 thefinancialphilosopher.com
129 buzzdelirium.com
130 bioforcesrl.com
131 codingupdates.com
132 usasimedia.com
133 elektron.ch
134 derbi.at
135 onepint.dk
136 bayoubeergarden.com
137 parisgayzik.com
138 capitatranslationinterpreting.com
139 tedhoagland.com
140 africaproject.info
141 nc-market.com
142 eroticsexybabes.com
143 flyredstar.org
144 agnezious.com
145 design-naturell.de
146 mjbm.pt
147 checkmygoodiebag.nl
148 heartt2000.org
149 rdyodjs.com
150 1556haus.com
151 sfpix.com
152 junited.de
153 oxbridgeacademy.co.za
154 aire-acondicionado-malaga.es
155 mm-terrace.com
156 webmart.de
157 miketnelson.com
158 homecleaningforyou.com
159 ordinaryministorage.com
160 ladysmithstory.org
161 alrobertson.co.uk
162 niapads.com
163 thecompleteuniversityguide.co.uk
164 alamopawnandjewelry.com
165 countrybiblechurch.org
166 quollective.com
167 misashin.com
168 4okflowers.com
169 diskant.sk
170 montereytestonly.com
171 pianoiseasy2.com
172 eurocaravans.pl
173 thesomersetapartments.com
174 esmartgroup.com
175 search-engine-book.co.uk
176 carriagehouseflowerswhiteplains.com
177 fivedaykitchens.com
178 ppni-sulut.or.id
179 utafreshmenconnect.org
180 coastaldentaltx.com
181 tamilmp3songslyrics.com
182 elhc.net
183 singluten.es
184 themaidsofcincy.com
185 catheterlegbag.com
186 wentzvillecc.org
187 comparecarpets-hardwoodflooring.com
188 gaches.com
189 hfcl.de
190 montimonumentsma.com
191 demontronddcj.com
192 au-kolyaska.ru
193 ohiotownships.org
194 kampalalodge.com
195 purbebe.com
196 vegas15.com
197 beachhotel.be
198 qms.bc.ca
199 expresspress.com
200 chirb.it
201 hao974.com
202 fantazia.org
203 poolbuilderssupply.net
204 marysfinds.com
205 schnipperlaw.com
206 qgnet.com.br
207 detamuzaktanegitim.com
208 compatibilitedesprenoms.fr
209 e-mailresponder.com
210 mineheadsomerset.co.uk
211 icfasd.org
212 aeroweldtech.com
213 infoerbe.it
214 newoldhymns.com
215 ninnananna.net
216 mediafiremax.com
217 gestorredessociales.es
218 stgilesjefferson.org
219 forerunners.ca
220 colorperfectsalon.com
221 compuremates.com.mx
222 laurakaardal.com
223 mauriziotesta.com
224 hindustangum.com
225 encompasscommunications.com
226 thrillsandskillsforlife.com
227 miwukvillage.org
228 chezplj.ca
229 nyibs.com
230 gemeentenatlas.nl
231 giveanurseabreak.com
232 sure-city.com
233 mus-mag.no
234 ccfj.net
235 ezcd.com
236 pranic-healing.in
237 sd.ac.th
238 paigntonholidayapartments.co.uk
239 arcadia-textiles.co.uk
240 terryoreillys.com
241 cwvhc.com
242 vieques-real-estate.com
243 gatewaychurchonline.org
244 studiom.lu
245 gummersontrack.com
246 moveyeg.ca
247 bematech.com
248 gwk.li
249 nile-consultants.com
250 carvingski.info
251 pafandco.com
252 billgoodwinmagic.com
253 packrad.de
254 211toronto.ca
255 blueskiesvi.com
256 tiersitters.de
257 toddkaram.com
258 mome.hu
259 fear3.es
260 countdownbooks.com
261 newlifeworshipcenter.org
262 cmvfr.org
263 dpstream.net
264 martrain.co.uk
265 shortsales.net
266 kawrose.pl
267 creditunions.cc
268 bestcareassist.ro
269 pta.nu
270 clubgirlsxxx.com
271 cathyakurtz.com
272 datadobi.com
273 caninechiro.com
274 bwdining.com
275 sisca.com.mx
276 nativeamericanchecks.net
277 duenodirecto.com.co
278 onlinetechnologycurriculum.com
279 blackteasociety.org
280 sb24.com
281 chickenslacks.com
282 thomaschunginsurance.com
283 restaurant-latmosphere.com
284 motortronics.com
285 mymilliontoone.com
286 ecobios.net
287 noblevitiligoclinic.com
288 alexandria.gov.eg
289 markoslerphotography.com
290 thepoems.net
291 pangeiainstrumentos.org
292 marketinguk.co.uk
293 emisorapotencialatina.com
294 drgendron.com
295 mesquiteaviation.com
296 namknights.com
297 mediaforest.biz
298 cseye.com
299 georgebaileyphotography.com
300 mosssongs.com
301 danophotoz.com
302 adventurestoursinperu.com
303 azbodymechanics.com
304 citypetcaretacoma.com
305 excelprofi.cz
306 jefferylawgroup.com
307 stanwatkins.net
308 completeagedcare.com
309 pooly.net
310 michellehendra.com
311 bensonsautomotive.com
312 freshnews.org
313 sol-but.pl
314 teensarea.com
315 fachanwalt.org
316 davellis.com
317 writers.ns.ca
318 escort-branchenbuch.de
319 alaknaksiberians.com
320 celebritychefclassic.com
321 kleitas.lv
322 psychoanalysisdownunder.com
323 lanticoborgo.net
324 oceansofimages.com
325 fourseasonsmodelt.com
326 immo-transaction.pro
327 regtwitgoedservice.nl
328 diennuocaz.com
329 mintloungeibiza.com
330 northsidetrailer.com
331 dailytube.tv
332 amha4u.com
The websites earn $5 a day
No. Domain name
0 americanmedicalautismboard.com
1 mnocia.org
2 quitoambiente.com
3 houtconstructies.com
4 stantoneng.com
5 aamxlac.com.mx
6 crez.org
7 murdochbooks.com
8 housingpartners.com
9 chcharlevoix.com
10 churchonthehill.co.uk
11 loanheadguitarclub.org
12 humboldt-weimar.de
13 stagetouring.com
14 boquetejazzandbluesfestival.com
15 broshuri.bg
16 kekz.de
17 gatewaytoheaven.co.uk
18 dnjautosales.com
19 sequimclassified.com
20 hubcapetown.com
21 minglewoodfarm.com
22 thousandpoundegg.com
23 actden.com
24 ecomanjar.com
25 beyondlimit.org
26 carrentalterengganu.com
27 polysoup.com
28 teraxtal.com
29 bracken-lodges.com
30 draperije.com
31 como-construir-una-piscina.com
32 looptivity.com
33 propack.ca
34 jumpcityhs.com
35 rutasrecomendables.com
36 msciwojow.pl
37 agendia.com
38 electricbeachfestival.co.uk
39 jerryreiflawyer.com
40 mitchell-hollow.com
41 jreagan.org
42 ristorantedariccardo.net
43 firsttownlaw.com
44 oakmotel.net
45 daphnehaiku.me
46 coonabarabran.com.au
47 bluegreencorp.com
48 firstmissionarybaptistwarsaw.com
49 dublin24.ie
50 attend.co.nz
51 psicologiamcastells.com
52 sneakyleaker.com
53 aalen-wasseralfingen.de
54 borderdriveways.co.uk
55 meeuwenveen.nl
56 homezoneinc.com
57 allo-pharmacie.org
58 bao-xin.com.tw
59 sexoenuruguay.com
60 cheerseventplanning.com
61 smart-teeth.com
62 spencercountyoctoberfest.com
63 kent-whitaker.com
64 dezonnestraal.nl
65 bsmonki.pl
66 theinsurancecrew.com
67 sinergiana.com
68 leukemiapictures.org
69 norfolknymuseum.com
70 siddallsroofingsheffield.co.uk
71 johnstantonbooks.com
72 cartenoua.com
73 eclipsept.net
74 meerforellenfliege-und-mehr.de
75 sinteza.info
76 skrmemo-edu.org
77 ethiopianism.net
78 dcpomatic.com
79 revive-iwaki.net
80 northernirelandclinicaltrials.co.uk
81 bhlogexpress.com.br
82 eskohistory.com
83 libyen-forum.de
84 flyawaysgold.com
85 searchscotland.net
86 insuremyhouse.co.uk
87 ekseventservices.co.uk
88 meoweather.com
89 oasisky.com
90 funshineclub.co.uk
91 exa-studio.com
92 blanqueamiento.com.ar
93 southernnewmexico.com
94 elegancki-prezent.pl
95 eurovoix.com
96 lipo-retard.com
97 sommerferien-jetzt.de
98 jeconsommeequitable.fr
99 crimsondawn.info
100 uniquetowels.com
101 majigs.com
102 chinagov.cn
103 nilweb.com
104 blogatelierdebybby.com
105 memo-pharma.fr
106 littleholeonbiglake.org
107 theroadtriprule.com
108 ashmeadowfarm.com
109 samhuntley.com
110 kevinpepin.com
111 gulfeast.com
112 daycenteronline.com
113 bomicanada.com
114 jiteshraniga.com
115 smlhomeandgarden.com
116 elinformantequeretaro.com
117 dickko.com
118 mastigalsnguys.com
119 lugano.com.au
120 circusmarcel.com
121 lebanondds.com
122 flashbind.com
123 doliosis.com
124 isonzeclub.nl
125 lowcards.com
126 faziarizvi.net
127 teamngapuhi.com
128 protestodf.com.br
129 externalbattery.net
130 schmidtandsons.com
131 raddudesfi.com
132 romorantin.com
133 somewhereincanada.com
134 bankjogja.com
135 crystalxcentre.com
136 knockhatchskicentre.co.uk
137 jaybensonlaw.com
138 puliart.com.tw
139 hometakes.com
140 dallasfa.com
141 hoteldegliolivi.com
142 bsmarket.ru
143 livekalasin.com
144 terrorpeut.de
145 90fmblumenau.com.br
146 buijsafbouw.be
147 bioscienceresearch.co.nz
148 campdora.cat
149 ilovework.nl
150 gtoddlaw.com
151 novinhasonline.net
152 earthlightnaturalfoodspa.com
153 pattonnet.com
154 superbowlsinglegirl.com
155 spoonerscreek.com
156 eastcoastrecycling.com
157 1-800-vitamins.com
158 ecropolis.eu
159 fpc-holt.org
160 hawaiistateparks.org
161 stambrosecambridge.ca
162 leolantz.com
163 fameccanica.cn
164 paint-web.net
165 lahdenmessut.fi
166 romulusrestaurant.co.uk
167 radiomariana.com.br
168 kalorpol.com
169 jonathandanieladams.com
170 dglogowear.com
171 vehiclecanopies.com
172 griffon-energy.com
173 ftbc.fr
174 bazaardelight.com
175 beijer.se
176 nic.do
177 christianjongeneel.nl
178 melderegister-auskunft.de
179 5ga2weather.com
180 santaritaauto.com
181 corecomputers.ca
182 eflashreload.com
183 skycoder.com
184 bentleyweddingcarsni.co.uk
185 rubengrande.com
186 farrar-bates.com
187 ckharlequins.com
188 acoturkiye.com
189 rellox.hu
190 richardpalalaymusic.com
191 alaashaheen.com
192 perrific.com
193 jensen-schmidt.com
194 jasonkohles.com
195 nattawut-fc.com
196 simple-shot.com
197 denvervideo.com
198 repaik.com
199 searscommerceservices.com
200 venueformeetup.com
201 bicyclesunl.com
202 dormiraamsterdam.com
203 chrzanow.dk
204 corcoranneighborhood.org
205 filmautor.org
206 golondrinas.info
207 proyectosinergia.com
208 lyapps.com
209 3steppayroll.com
210 umberto40.ru
211 ballardenterprises.com
212 bwabbeyinn.com
213 customcreation.net
214 solidwingsails.com
215 casacoima.com
216 klunzshop.dk
217 cm13.it
218 elsenordelasuerte.com
219 natural-science.or.jp
220 doriklass.com
221 fabet.com.pl
222 allforhair.com
223 oomoxx.com
224 salamaco.com
225 escolacici.com.br
226 castleclashhacktool.com
227 manipuladoralimentos.es
228 merchantbanc.com
229 lingenfeld.de
230 dadsbadjokes.com
231 netbasis.com
232 ricobriquetteplant.com
233 mazik.co.il
234 tinroostermedia.com
235 meushihtzu.com
236 dan-grover.com
237 veteran-auto.hu
238 erektio.org
239 bosshogbikes.com
240 jopera.at
241 bandkarts.com
242 bring-communication.com
243 egyptbooks.net
244 ferienwohnungflaesheim.de
245 spinflyer.com
246 janjansen.asia
247 smibrookbendapts.com
248 halterhorseads.com
249 pegasusclinics.com
250 lakeshoreyoga.com
251 ncaainsurance.com
252 news-hackers.eu
253 newbould.com
254 christrenewshisparish.com
255 buddhaway.org
256 americanmarinafla.com
257 banmaischool.vn
258 maryzolp.com
259 midrandconferencecentre.co.za
260 blackcreekcrossing.com
261 falcon-crestbb.com
262 larchmontgrill.com
263 sdcers.org
264 lightingelstore.com
265 assistanceannuaire411.ca
266 windfishpro.com
267 newhampshirecakes.com
268 lenzencenter.com
269 florestaaguadonorte.com.br
270 aubournhall.co.uk
271 casaejardim.eu
272 connect-sprachenservice.at
273 tintenstich.de
274 abbevillefilm.com
275 irontraffic.com
276 lcbo.com
277 nextdestinationvienna.com
278 automobile-david.de
279 candice.net
280 bayareathemes.com
281 acal.com.br
282 themuseumofinnocence.com
283 blue-rose-linedancer.de
284 academies-se.org
285 scientistsinschool.ca
286 northernfairfieldinsurance.com
287 gcmayorkshire.org.uk
288 hornillosdelcamino.es
289 interzonepost.com
290 ingenierosasesores.com
291 milanodoha.com.qa
292 stels1.com
293 bassriverhistory.org
294 petroleum.utm.my
295 segurosdemoto.com.br
296 shiatsujura.fr
297 ecesalici.com
298 ecomm2012.eu
299 bodpod.com
300 hudginsrealestate.com
301 lakebarcroft.com
302 felicenyc.com
303 conservationdecoys.com
304 pastamania.com.sg
305 seoulcom.or.kr
306 foxqualityknives.com
307 acfixr.com
308 sescappe.org.br
309 adriansrestaurant.com
310 mafiacorruption.com
311 grasshopperadventureseries.com
312 infinitheatre.com
313 sistersvintageparty.com
314 cmacma.com
315 mikiel.net
316 adreamcalledfashion.com
317 crazyfastinternet.com
318 saltleymethodistchurch.org.uk
319 tampabaytowing.net
320 adobephotoshopvideos.com
321 dvkapital.ru
322 baseboardcorners.com
323 megra.ca
324 tender-ertesito.hu
325 haftkomputerowy.net
326 norcalna.org
327 ccdservices.com
328 faceliftboston.com
329 gsc.com.co
330 delrayfarms.org
331 colingregorypalmer.net
332 myamericanshopper.com
The websites earn $5 a month
No. Domain name
0 blushoccasions.com
1 medilodgeofstclair.com
2 wcrmichigan.com
3 ecocontrol.co.uk
4 dcimobile.com
5 abc-opleidingen.nl
6 lumperladen.de
7 stlouisramsproshop.com
8 1718best.com
9 dakotastonedesign.com
10 dieladielka.sk
11 discoid.it
12 imgvideos.com
13 homeswithin45minutesofdc-baltimore.com
14 edukate.net
15 homeessentialsfrederick.com
16 usack.com
17 bauer-ghana.com
18 generali-intl.com
19 arkbuildings.com
20 hapantoten.pl
21 drivescool.co.nz
22 centraltexasbilliards.com
23 location-voiture-au-maroc.com
24 mineolatrophy.com
25 electrolab.com
26 kaiserhofkeller.com
27 viraway.com
28 oceanfalls.org
29 2072productions.com
30 milwood.eu
31 harvestfolkfestival.com
32 hoovolution.com
33 instrukcije-anglescine.si
34 edisoncomputers.com
35 mainecav.org
36 justindegarmo.com
37 ottosbmw.com
38 no-violence.net
39 nirajpublicschool.com
40 opgraven.nl
41 friedliebbyrne.com.au
42 bidascript.com
43 crestviewgcofkalamazoo.com
44 acls.net
45 lakelanefishingandcampinggetaway.com
46 sek-team.net
47 lingerie-sex.net
48 viewerlink.tv
49 ciprianousa.com
50 rollinghillsvethospital.com
51 ciid.ro
52 mosaicaonlineedu.com
53 converseit.com
54 macltd.com
55 ronhamp.com
56 directpaydayloancash.com
57 hotelgrand.sk
58 enqueteur-cic.com
59 robsmithphotos.com
60 biomus.lu.se
61 josefincasteryd.se
62 anenglishgardenbb.com
63 odbojnice-sklep.pl
64 reunited.us
65 fukudenkai.or.jp
66 canvascondos.com
67 esadvertising.net
68 grundeis.net
69 dogwoodstudio.net
70 guesthouseellensburg.com
71 mandygarcia.com
72 ultraninjas.com
73 mygreeneducation.com
74 klasakatowice.pun.pl
75 jowa-usa.com
76 servicemasterbyintegrity.com
77 thewillitsshakespearecompany.org
78 kgldcable.net
79 cluburidepoker.ro
80 ideacalcio.net
81 drivingschoolprofessional.com
82 aaanpanama.com
83 rakhawy.org
84 contra-przyjecia.pl
85 flybynightvideos.com
86 ato.tw
87 telegazeta.pcu.pl
88 colombiculturacv.es
89 prezerwatywy.info
90 mariss.pl
91 hot-pocketz.com
92 crescentcards.co.uk
93 makespacearts.com
94 locatingaustinapartments.com
95 lauramay.co.uk
96 nguoiviethome.com
97 justsaladfranchise.com
98 rawnsleyhairrestoration.com
99 dakota-lodge.com
100 digrap.com
101 kappey.de
102 imaginemefoundation.org
103 improvenow.com
104 albertacarpetcleaningcalgary.ca
105 barbecuegrilltools.com
106 ncaazk.com
107 quasi-s.com.sg
108 dimledlights.com
109 gomonica.com
110 nayoya.com
111 inservice.com.ar
112 olathessaloniki.com
113 decatering.be
114 campuskickoff.com
115 agta.az
116 microlinslondrina.com.br
117 joygospel.com
118 littleobservationist.com
119 eggdesign.com
120 foundry-eqpt.com
121 connectedcreativity.com
122 dawnmusic.com
123 redtone.es
124 facoachingbadges.co.uk
125 emartinka.cz
126 engnet.co.za
127 extensionpatio.com
128 emmsa.com.pe
129 wheatleyflooringltd.co.uk
130 ecohotelelreposo.com
131 photodesignfriedrich.de
132 seabreez.com
133 nico-herrmann.de
134 depaulaepis.com.br
135 skmotors.cc
136 deeptissuejs.com
137 child-psych.org
138 i9store.com.br
139 louisiane-fmi.com
140 dimiron.com.br
141 mothwurf.com
142 compagnie-maguy-marin.fr
143 thefbch.org
144 orbital.net
145 solarmag.com.co
146 lattitude.co
147 pl-259.com
148 kimind.net
149 autogru.biz
150 garajevalencia.net
151 usw10-86.org
152 forcefieldnow.org
153 citizensinspace.org
154 bhangrajunction.com
155 fotoshoppa.se
156 bar-plans.com
157 craftybutterfly.co.uk
158 lakoniagreekproducts.com
159 astellas.com.tw
160 galtendyreklinik.dk
161 slagmolen.be
162 csainequitazione.com
163 childrensportraits.net
164 familyoncall.com
165 kellyalison.com
166 remodelingmcallen.com
167 multiflower14.nl
168 heartlandforensic.com
169 greenvillesegwaytours.com
170 homeinspections-pa.com
171 bad-credit-mortgage-refinance.net
172 cccares4u.com
173 stphilomenas.in
174 namioty-weselne.com.pl
175 l-emedia.com
176 chfweb.com
177 forestdhammabooks.com
178 exhibweb.com
179 madisoncomedy.com
180 certificats-de-cession.fr
181 undercoverboss.com
182 honesturbanist.com
183 factsforlifethai.info
184 janeprobstlaw.com
185 datatable.com
186 advarsitysports.com
187 peter-cockerell.net
188 etgcn.com
189 cilantrofilms.com
190 ehrana.si
191 pfizer.com.my
192 catandbirds.com
193 racetx.com
194 joshjitsu.info
195 packerforum.com
196 epilegin.gr
197 dragonflyproject.org
198 ocsab.se
199 bethelsc.org
200 kibrispazarlama.com
201 espacosideral.com.br
202 thedoorpost.com
203 aspektpublishing.com
204 kidspartysolutions.com
205 handjobcumshots.org
206 pyarkidhun.com
207 cestriacycles.co.uk
208 dolciricordi.co.uk
209 audiosoundclips.com
210 smartcaching.de
211 amdonlus.it
212 imprest.cz
213 radutils.com
214 furnasmanright-time.ca
215 pixelcolor.com.mx
216 inkandaprons.com
217 saintdanes.com
218 crankywino.com
219 mon-ga.com.tw
220 oliverames.org
221 socalxrs.com
222 vortio.com
223 cumminsrealestate.com
224 oenobiol.es
225 christinney.com
226 hospitalmboimirim.com.br
227 livenakedcams.co.uk
228 nhlibertycalendar.org
229 oingtv.com
230 handsforcambodia.com
231 expounion.ru
232 gratis-produktproben.com
233 kibbutzhotels.co.il
234 oslovrenc.si
235 kidsorbit.com
236 sagemarie.com
237 cdimodelrocketry.com
238 crowlandproductions.com
239 choosechicago.com
240 invasivespeciescouncil.com
241 hirsch-nebringen.de
242 gayschempp.com
243 elmadar.org
244 abortnet.dk
245 culturalij.com
246 givingchi.com
247 somekindofparadise.com
248 ellingtonob-gyn.com
249 issuma.com
250 pyinfamous.com
251 fegrup.net
252 ijournal.org
253 alaskanequipmenttrader.com
254 infinitetherapies.com
255 eviloverlord.com
256 forecastsandtrends.com
257 olddeathwhisper.net
258 fitnesshouse.spb.ru
259 kayxie.co.uk
260 hasbilling.com
261 02773d.com
262 laser-design-services.com
263 discobar-corona.be
264 autogear.fi
265 vymyvany-beton.sk
266 degeheimezender.nl
267 cateringdetoren.nl
268 sellersandseekers.com
269 backgammonmanopen.com
270 rocblanc.com
271 kohrstheoriginal.com
272 jcw.be
273 muinastuled.ee
274 petersspares.com
275 myattsfield.com.au
276 thelastkingdom.net
277 ek-leipzig.de
278 straightupproductions.com
279 delawareptac.org
280 thebarc.co.uk
281 over-board.co.uk
282 scotscollege.org
283 bestsanantoniostripclubs.com
284 cmf-ltd.com
285 suetrent.com
286 mw3cod.com
287 solferinoassocies.com
288 avtovokzaly.ru
289 readaloudwestvirginia.org
290 atypicaldevelopment.com
291 cav-aerospace.net
292 weather-all.com
293 seksshop.com.tr
294 golsn.net
295 dragaodosol.com.br
296 allxxxporn.com
297 ptaylorart.com
298 usscorson.com
299 scentfree.ca
300 cavsheadhouse.com
301 rivadoucebebe.fr
302 onlinedrivingjobs.com
303 pousadaesperanca.com.br
304 cookclaimsinc.com
305 dkmtools.nl
306 lexingtonchatroom.com
307 rubenvandervleuten.com
308 comicbookmovies.us
309 leighbythesea.co.nz
310 leru.org.uk
311 catillnesses.net
312 schoolsbuyingclub.com
313 ats-us.org
314 chrisagos.com
315 sciencofast.com
316 gb3ig.co.uk
317 welligent.com
318 grandecampina.com.br
319 thefinancesection.com
320 tinapurwininsurance.com
321 earthwiseenvironmental.com
322 pompestudy.com
323 akaisguvenlik.com
324 adultcare.org
325 notice.ru
326 ipadclubmalaysia.com
327 rimax.net
328 easyticket24.com
329 crystalimagesphotography.net
330 stickycarpet.com
331 crestwoodjewelers.com
332 mediapark.de